DDIT4L monoclonal antibody (M01), clone 2E6 View larger

DDIT4L monoclonal antibody (M01), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDIT4L monoclonal antibody (M01), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about DDIT4L monoclonal antibody (M01), clone 2E6

Brand: Abnova
Reference: H00115265-M01
Product name: DDIT4L monoclonal antibody (M01), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant DDIT4L.
Clone: 2E6
Isotype: IgG2a Kappa
Gene id: 115265
Gene name: DDIT4L
Gene alias: REDD2|Rtp801L
Gene description: DNA-damage-inducible transcript 4-like
Genbank accession: NM_145244
Immunogen: DDIT4L (NP_660287, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
Protein accession: NP_660287
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115265-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged DDIT4L is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy DDIT4L monoclonal antibody (M01), clone 2E6 now

Add to cart