Brand: | Abnova |
Reference: | H00115265-M01 |
Product name: | DDIT4L monoclonal antibody (M01), clone 2E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDIT4L. |
Clone: | 2E6 |
Isotype: | IgG2a Kappa |
Gene id: | 115265 |
Gene name: | DDIT4L |
Gene alias: | REDD2|Rtp801L |
Gene description: | DNA-damage-inducible transcript 4-like |
Genbank accession: | NM_145244 |
Immunogen: | DDIT4L (NP_660287, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
Protein accession: | NP_660287 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DDIT4L is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |