MARCH3 monoclonal antibody (M03), clone 1F6 View larger

MARCH3 monoclonal antibody (M03), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MARCH3 monoclonal antibody (M03), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about MARCH3 monoclonal antibody (M03), clone 1F6

Brand: Abnova
Reference: H00115123-M03
Product name: MARCH3 monoclonal antibody (M03), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant MARCH3.
Clone: 1F6
Isotype: IgG2b Kappa
Gene id: 115123
Gene name: MARCH3
Gene alias: FLJ20096|MARCH-III|MGC48332|RNF173
Gene description: membrane-associated ring finger (C3HC4) 3
Genbank accession: NM_178450
Immunogen: MARCH3 (NP_848545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSC
Protein accession: NP_848545
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115123-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115123-M03-13-15-1.jpg
Application image note: Western Blot analysis of MARCH3 expression in transfected 293T cell line by MARCH3 monoclonal antibody (M03), clone 1F6.

Lane 1: MARCH3 transfected lysate (Predicted MW: 28.5 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MARCH3 monoclonal antibody (M03), clone 1F6 now

Add to cart