CCDC5 monoclonal antibody (M01), clone 1E3 View larger

CCDC5 monoclonal antibody (M01), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCDC5 monoclonal antibody (M01), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CCDC5 monoclonal antibody (M01), clone 1E3

Brand: Abnova
Reference: H00115106-M01
Product name: CCDC5 monoclonal antibody (M01), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant CCDC5.
Clone: 1E3
Isotype: IgG2a Kappa
Gene id: 115106
Gene name: CCDC5
Gene alias: FLJ21094|FLJ40084|HEI-C|HsT1461
Gene description: coiled-coil domain containing 5 (spindle associated)
Genbank accession: NM_138443
Immunogen: CCDC5 (NP_612452.1, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
Protein accession: NP_612452.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115106-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115106-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CCDC5 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CCDC5 monoclonal antibody (M01), clone 1E3 now

Add to cart