SLC26A9 monoclonal antibody (M02), clone 4E9 View larger

SLC26A9 monoclonal antibody (M02), clone 4E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC26A9 monoclonal antibody (M02), clone 4E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC26A9 monoclonal antibody (M02), clone 4E9

Brand: Abnova
Reference: H00115019-M02
Product name: SLC26A9 monoclonal antibody (M02), clone 4E9
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC26A9.
Clone: 4E9
Isotype: IgG2b Kappa
Gene id: 115019
Gene name: SLC26A9
Gene alias: -
Gene description: solute carrier family 26, member 9
Genbank accession: NM_052934
Immunogen: SLC26A9 (NP_443166, 496 a.a. ~ 605 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENA
Protein accession: NP_443166
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115019-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115019-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC26A9 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC26A9 monoclonal antibody (M02), clone 4E9 now

Add to cart