VASN monoclonal antibody (M05A), clone 4G7 View larger

VASN monoclonal antibody (M05A), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VASN monoclonal antibody (M05A), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about VASN monoclonal antibody (M05A), clone 4G7

Brand: Abnova
Reference: H00114990-M05A
Product name: VASN monoclonal antibody (M05A), clone 4G7
Product description: Mouse monoclonal antibody raised against a partial recombinant VASN.
Clone: 4G7
Isotype: IgG2a Kappa
Gene id: 114990
Gene name: VASN
Gene alias: SLITL2
Gene description: vasorin
Genbank accession: NM_138440
Immunogen: VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Protein accession: NP_612449
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114990-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114990-M05A-13-15-1.jpg
Application image note: Western Blot analysis of VASN expression in transfected 293T cell line by VASN monoclonal antibody (M05A), clone 4G7.

Lane 1: VASN transfected lysate (Predicted MW: 71.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VASN monoclonal antibody (M05A), clone 4G7 now

Add to cart