VASN monoclonal antibody (M05), clone 4G7 View larger

VASN monoclonal antibody (M05), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VASN monoclonal antibody (M05), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about VASN monoclonal antibody (M05), clone 4G7

Brand: Abnova
Reference: H00114990-M05
Product name: VASN monoclonal antibody (M05), clone 4G7
Product description: Mouse monoclonal antibody raised against a partial recombinant VASN.
Clone: 4G7
Isotype: IgG2a Kappa
Gene id: 114990
Gene name: VASN
Gene alias: SLITL2
Gene description: vasorin
Genbank accession: NM_138440
Immunogen: VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Protein accession: NP_612449
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114990-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114990-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged VASN is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Exosomal Transfer of Vasorin Expressed in Hepatocellular Carcinoma Cells Promotes Migration of Human Umbilical Vein Endothelial Cells.Huang A, Dong J, Li S, Wang C, Ding H, Li H, Su X, Ge X, Sun L, Bai C, Shen X, Fang T, Li J, Shao N.
Int. J. Biol. Sci. 2015; 11(8): 961-969

Reviews

Buy VASN monoclonal antibody (M05), clone 4G7 now

Add to cart