TMEM123 monoclonal antibody (M02), clone 1F4 View larger

TMEM123 monoclonal antibody (M02), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM123 monoclonal antibody (M02), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about TMEM123 monoclonal antibody (M02), clone 1F4

Brand: Abnova
Reference: H00114908-M02
Product name: TMEM123 monoclonal antibody (M02), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TMEM123.
Clone: 1F4
Isotype: IgG1 Kappa
Gene id: 114908
Gene name: TMEM123
Gene alias: KCT3|PORIMIN|PORMIN
Gene description: transmembrane protein 123
Genbank accession: NM_052932
Immunogen: TMEM123 (NP_443164, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITT
Protein accession: NP_443164
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114908-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114908-M02-13-15-1.jpg
Application image note: Western Blot analysis of TMEM123 expression in transfected 293T cell line by TMEM123 monoclonal antibody (M02), clone 1F4.

Lane 1: TMEM123 transfected lysate (Predicted MW: 21.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TMEM123 monoclonal antibody (M02), clone 1F4 now

Add to cart