Brand: | Abnova |
Reference: | H00114907-M02 |
Product name: | FBXO32 monoclonal antibody (M02), clone 1D6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FBXO32. |
Clone: | 1D6 |
Isotype: | IgG2a Kappa |
Gene id: | 114907 |
Gene name: | FBXO32 |
Gene alias: | FLJ32424|Fbx32|MAFbx|MGC33610 |
Gene description: | F-box protein 32 |
Genbank accession: | BC024030 |
Immunogen: | FBXO32 (AAH24030.1, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
Protein accession: | AAH24030.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |