Cart 5 Product Products 1 826,41 € (empty)
-
1 x PAKα/β/γ...259,07 € -
-
-
-
No products
To be determined Shipping
1 826,41 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 826,41 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 826,41 €
Data sheet of FBXO32 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FBXO32 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00114907-B01P |
| Product name: | FBXO32 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FBXO32 protein. |
| Gene id: | 114907 |
| Gene name: | FBXO32 |
| Gene alias: | FLJ32424|Fbx32|MAFbx|MGC33610 |
| Gene description: | F-box protein 32 |
| Genbank accession: | NM_058229.2 |
| Immunogen: | FBXO32 (ENSP00000287396, 1 a.a. ~ 355 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
| Protein accession: | ENSP00000287396 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FBXO32 expression in transfected 293T cell line (H00114907-T01) by FBXO32 MaxPab polyclonal antibody. Lane 1: FBXO32 transfected lysate(39.05 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |