Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00114898-M01 |
Product name: | C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant C1QTNF2. |
Clone: | 1D7-2C7 |
Isotype: | IgG2a kappa |
Gene id: | 114898 |
Gene name: | C1QTNF2 |
Gene alias: | CTRP2|zacrp2 |
Gene description: | C1q and tumor necrosis factor related protein 2 |
Genbank accession: | BC011699 |
Immunogen: | C1QTNF2 (AAH11699.1, 16 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV |
Protein accession: | AAH11699.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (55.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of C1QTNF2 expression in transfected 293T cell line by C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7. Lane 1: C1QTNF2 transfected lysate(32.775 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |