C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7 View larger

C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

Brand: Abnova
Reference: H00114898-M01
Product name: C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7
Product description: Mouse monoclonal antibody raised against a full length recombinant C1QTNF2.
Clone: 1D7-2C7
Isotype: IgG2a kappa
Gene id: 114898
Gene name: C1QTNF2
Gene alias: CTRP2|zacrp2
Gene description: C1q and tumor necrosis factor related protein 2
Genbank accession: BC011699
Immunogen: C1QTNF2 (AAH11699.1, 16 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV
Protein accession: AAH11699.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114898-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114898-M01-13-15-1.jpg
Application image note: Western Blot analysis of C1QTNF2 expression in transfected 293T cell line by C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7.

Lane 1: C1QTNF2 transfected lysate(32.775 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7 now

Add to cart