OSBPL8 monoclonal antibody (M02), clone 4H6 View larger

OSBPL8 monoclonal antibody (M02), clone 4H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBPL8 monoclonal antibody (M02), clone 4H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about OSBPL8 monoclonal antibody (M02), clone 4H6

Brand: Abnova
Reference: H00114882-M02
Product name: OSBPL8 monoclonal antibody (M02), clone 4H6
Product description: Mouse monoclonal antibody raised against a partial recombinant OSBPL8.
Clone: 4H6
Isotype: IgG2a Kappa
Gene id: 114882
Gene name: OSBPL8
Gene alias: DKFZp686A11164|MGC126578|MGC133203|MST120|MSTP120|ORP8|OSBP10
Gene description: oxysterol binding protein-like 8
Genbank accession: NM_020841
Immunogen: OSBPL8 (NP_065892.1, 244 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV
Protein accession: NP_065892.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114882-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114882-M02-1-6-1.jpg
Application image note: OSBPL8 monoclonal antibody (M02), clone 4H6. Western Blot analysis of OSBPL8 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OSBPL8 monoclonal antibody (M02), clone 4H6 now

Add to cart