Brand: | Abnova |
Reference: | H00114882-M02 |
Product name: | OSBPL8 monoclonal antibody (M02), clone 4H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OSBPL8. |
Clone: | 4H6 |
Isotype: | IgG2a Kappa |
Gene id: | 114882 |
Gene name: | OSBPL8 |
Gene alias: | DKFZp686A11164|MGC126578|MGC133203|MST120|MSTP120|ORP8|OSBP10 |
Gene description: | oxysterol binding protein-like 8 |
Genbank accession: | NM_020841 |
Immunogen: | OSBPL8 (NP_065892.1, 244 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV |
Protein accession: | NP_065892.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | OSBPL8 monoclonal antibody (M02), clone 4H6. Western Blot analysis of OSBPL8 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |