OSBPL7 monoclonal antibody (M03), clone 3D11 View larger

OSBPL7 monoclonal antibody (M03), clone 3D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBPL7 monoclonal antibody (M03), clone 3D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about OSBPL7 monoclonal antibody (M03), clone 3D11

Brand: Abnova
Reference: H00114881-M03
Product name: OSBPL7 monoclonal antibody (M03), clone 3D11
Product description: Mouse monoclonal antibody raised against a partial recombinant OSBPL7.
Clone: 3D11
Isotype: IgG2b Kappa
Gene id: 114881
Gene name: OSBPL7
Gene alias: MGC71150|ORP7
Gene description: oxysterol binding protein-like 7
Genbank accession: NM_145798
Immunogen: OSBPL7 (NP_665741.1, 742 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIEQLQRDRRKVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYGNMDGAVLW
Protein accession: NP_665741.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114881-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OSBPL7 monoclonal antibody (M03), clone 3D11 now

Add to cart