Brand: | Abnova |
Reference: | H00114880-M01A |
Product name: | OSBPL6 monoclonal antibody (M01A), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OSBPL6. |
Clone: | 1C8 |
Isotype: | IgG1 Kappa |
Gene id: | 114880 |
Gene name: | OSBPL6 |
Gene alias: | FLJ36583|MGC59642|ORP6 |
Gene description: | oxysterol binding protein-like 6 |
Genbank accession: | NM_145739 |
Immunogen: | OSBPL6 (NP_665682.1, 344 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQMARLRQSLSQALNQNAELRS |
Protein accession: | NP_665682.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |