OSBPL6 monoclonal antibody (M01A), clone 1C8 View larger

OSBPL6 monoclonal antibody (M01A), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBPL6 monoclonal antibody (M01A), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about OSBPL6 monoclonal antibody (M01A), clone 1C8

Brand: Abnova
Reference: H00114880-M01A
Product name: OSBPL6 monoclonal antibody (M01A), clone 1C8
Product description: Mouse monoclonal antibody raised against a partial recombinant OSBPL6.
Clone: 1C8
Isotype: IgG1 Kappa
Gene id: 114880
Gene name: OSBPL6
Gene alias: FLJ36583|MGC59642|ORP6
Gene description: oxysterol binding protein-like 6
Genbank accession: NM_145739
Immunogen: OSBPL6 (NP_665682.1, 344 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQMARLRQSLSQALNQNAELRS
Protein accession: NP_665682.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy OSBPL6 monoclonal antibody (M01A), clone 1C8 now

Add to cart