OSBPL5 polyclonal antibody (A01) View larger

OSBPL5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBPL5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about OSBPL5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00114879-A01
Product name: OSBPL5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant OSBPL5.
Gene id: 114879
Gene name: OSBPL5
Gene alias: FLJ42929|OBPH1|ORP5
Gene description: oxysterol binding protein-like 5
Genbank accession: NM_145638
Immunogen: OSBPL5 (NP_663613, 4 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETL
Protein accession: NP_663613
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114879-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OSBPL5 polyclonal antibody (A01) now

Add to cart