Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00114836-B01 |
Product name: | SLAMF6 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human SLAMF6 protein. |
Gene id: | 114836 |
Gene name: | SLAMF6 |
Gene alias: | KALI|KALIb|Ly108|MGC104953|NTB-A|NTBA|SF2000 |
Gene description: | SLAM family member 6 |
Genbank accession: | BC090928.1 |
Immunogen: | SLAMF6 (AAH90928.1, 1 a.a. ~ 271 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS |
Protein accession: | AAH90928.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SLAMF6 expression in transfected 293T cell line (H00114836-T01) by SLAMF6 MaxPab polyclonal antibody. Lane 1: SLAMF6 transfected lysate(29.81 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | The Adaptor Protein SAP Directly Associates with CD3ζ Chain and Regulates T Cell Receptor Signaling.Proust R, Bertoglio J, Gesbert F. PLoS One. 2012;7(8):e43200. Epub 2012 Aug 13. |