Brand: | Abnova |
Reference: | H00114814-M02 |
Product name: | GNRHR2 monoclonal antibody (M02), clone 1A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GNRHR2. |
Clone: | 1A5 |
Isotype: | IgG1 Kappa |
Gene id: | 114814 |
Gene name: | GNRHR2 |
Gene alias: | GnRH-II-R |
Gene description: | gonadotropin-releasing hormone (type 2) receptor 2 |
Genbank accession: | NM_057163 |
Immunogen: | GNRHR2 (NP_001457, 237 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI |
Protein accession: | NP_001457 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GNRHR2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |