GALNT13 monoclonal antibody (M04), clone 3F3 View larger

GALNT13 monoclonal antibody (M04), clone 3F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNT13 monoclonal antibody (M04), clone 3F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GALNT13 monoclonal antibody (M04), clone 3F3

Brand: Abnova
Reference: H00114805-M04
Product name: GALNT13 monoclonal antibody (M04), clone 3F3
Product description: Mouse monoclonal antibody raised against a partial recombinant GALNT13.
Clone: 3F3
Isotype: IgG2b Kappa
Gene id: 114805
Gene name: GALNT13
Gene alias: FLJ16031|FLJ41157|GalNAc-T13|H_NH0187G20.1|KIAA1918|MGC119459|MGC119461|WUGSC:H_NH0187G20.1
Gene description: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)
Genbank accession: NM_052917
Immunogen: GALNT13 (NP_443149.1, 47 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVI
Protein accession: NP_443149.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114805-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114805-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GALNT13 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GALNT13 monoclonal antibody (M04), clone 3F3 now

Add to cart