RNF157 monoclonal antibody (M01), clone 6B3 View larger

RNF157 monoclonal antibody (M01), clone 6B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF157 monoclonal antibody (M01), clone 6B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RNF157 monoclonal antibody (M01), clone 6B3

Brand: Abnova
Reference: H00114804-M01
Product name: RNF157 monoclonal antibody (M01), clone 6B3
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF157.
Clone: 6B3
Isotype: IgG1 Kappa
Gene id: 114804
Gene name: RNF157
Gene alias: -
Gene description: ring finger protein 157
Genbank accession: NM_052916
Immunogen: RNF157 (NP_443148, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PASRAPSEEGEGLPAESPDSNFAGLPAGEQDAEGNDVIEEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ
Protein accession: NP_443148
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114804-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114804-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RNF157 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF157 monoclonal antibody (M01), clone 6B3 now

Add to cart