Brand: | Abnova |
Reference: | H00114793-M01 |
Product name: | FMNL2 monoclonal antibody (M01), clone 2B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FMNL2. |
Clone: | 2B4 |
Isotype: | IgG1 Kappa |
Gene id: | 114793 |
Gene name: | FMNL2 |
Gene alias: | FHOD2|FLJ37546 |
Gene description: | formin-like 2 |
Genbank accession: | BC036492 |
Immunogen: | FMNL2 (AAH36492, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS |
Protein accession: | AAH36492 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.32 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FMNL2 monoclonal antibody (M01), clone 2B4 Western Blot analysis of FMNL2 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Epigenetic silencing of miR137 in gastric cancer.Jin W, Jiang T, Sun J, Xu W, Feng L, Jin H, Wang X. Int J Clin Exp Med. 2016 Sep 30;9(9):17926-17932. |