FMNL2 monoclonal antibody (M01), clone 2B4 View larger

FMNL2 monoclonal antibody (M01), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FMNL2 monoclonal antibody (M01), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FMNL2 monoclonal antibody (M01), clone 2B4

Brand: Abnova
Reference: H00114793-M01
Product name: FMNL2 monoclonal antibody (M01), clone 2B4
Product description: Mouse monoclonal antibody raised against a full length recombinant FMNL2.
Clone: 2B4
Isotype: IgG1 Kappa
Gene id: 114793
Gene name: FMNL2
Gene alias: FHOD2|FLJ37546
Gene description: formin-like 2
Genbank accession: BC036492
Immunogen: FMNL2 (AAH36492, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS
Protein accession: AAH36492
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114793-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114793-M01-1-19-1.jpg
Application image note: FMNL2 monoclonal antibody (M01), clone 2B4 Western Blot analysis of FMNL2 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Epigenetic silencing of miR137 in gastric cancer.Jin W, Jiang T, Sun J, Xu W, Feng L, Jin H, Wang X.
Int J Clin Exp Med. 2016 Sep 30;9(9):17926-17932.

Reviews

Buy FMNL2 monoclonal antibody (M01), clone 2B4 now

Add to cart