TUBGCP5 monoclonal antibody (M01), clone 2H5 View larger

TUBGCP5 monoclonal antibody (M01), clone 2H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TUBGCP5 monoclonal antibody (M01), clone 2H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TUBGCP5 monoclonal antibody (M01), clone 2H5

Brand: Abnova
Reference: H00114791-M01
Product name: TUBGCP5 monoclonal antibody (M01), clone 2H5
Product description: Mouse monoclonal antibody raised against a partial recombinant TUBGCP5.
Clone: 2H5
Isotype: IgG2a Kappa
Gene id: 114791
Gene name: TUBGCP5
Gene alias: GCP5|KIAA1899
Gene description: tubulin, gamma complex associated protein 5
Genbank accession: NM_052903
Immunogen: TUBGCP5 (NP_443135.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI
Protein accession: NP_443135.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114791-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TUBGCP5 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TUBGCP5 monoclonal antibody (M01), clone 2H5 now

Add to cart