SLC25A25 monoclonal antibody (M02), clone 4D8 View larger

SLC25A25 monoclonal antibody (M02), clone 4D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A25 monoclonal antibody (M02), clone 4D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SLC25A25 monoclonal antibody (M02), clone 4D8

Brand: Abnova
Reference: H00114789-M02
Product name: SLC25A25 monoclonal antibody (M02), clone 4D8
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC25A25.
Clone: 4D8
Isotype: IgG2a Kappa
Gene id: 114789
Gene name: SLC25A25
Gene alias: KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2
Gene description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
Genbank accession: NM_052901
Immunogen: SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL
Protein accession: NP_443133
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114789-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114789-M02-13-15-1.jpg
Application image note: Western Blot analysis of SLC25A25 expression in transfected 293T cell line by SLC25A25 monoclonal antibody (M02), clone 4D8.

Lane 1: SLC25A25 transfected lysate(52.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLC25A25 monoclonal antibody (M02), clone 4D8 now

Add to cart