Brand: | Abnova |
Reference: | H00114789-A01 |
Product name: | SLC25A25 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC25A25. |
Gene id: | 114789 |
Gene name: | SLC25A25 |
Gene alias: | KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2 |
Gene description: | solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 |
Genbank accession: | NM_052901 |
Immunogen: | SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL |
Protein accession: | NP_443133 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |