SLC25A25 polyclonal antibody (A01) View larger

SLC25A25 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A25 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC25A25 polyclonal antibody (A01)

Brand: Abnova
Reference: H00114789-A01
Product name: SLC25A25 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC25A25.
Gene id: 114789
Gene name: SLC25A25
Gene alias: KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2
Gene description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
Genbank accession: NM_052901
Immunogen: SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL
Protein accession: NP_443133
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114789-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC25A25 polyclonal antibody (A01) now

Add to cart