Brand: | Abnova |
Reference: | H00114783-M03 |
Product name: | LMTK3 monoclonal antibody (M03), clone 6C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LMTK3. |
Clone: | 6C5 |
Isotype: | IgG2a Kappa |
Gene id: | 114783 |
Gene name: | LMTK3 |
Gene alias: | KIAA1883|LMR3|TYKLM3 |
Gene description: | lemur tyrosine kinase 3 |
Genbank accession: | XM_055866 |
Immunogen: | LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG |
Protein accession: | XP_055866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LMTK3 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |