LMTK3 monoclonal antibody (M02A), clone 2H6 View larger

LMTK3 monoclonal antibody (M02A), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMTK3 monoclonal antibody (M02A), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about LMTK3 monoclonal antibody (M02A), clone 2H6

Brand: Abnova
Reference: H00114783-M02A
Product name: LMTK3 monoclonal antibody (M02A), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant LMTK3.
Clone: 2H6
Isotype: IgG1 Kappa
Gene id: 114783
Gene name: LMTK3
Gene alias: KIAA1883|LMR3|TYKLM3
Gene description: lemur tyrosine kinase 3
Genbank accession: XM_055866
Immunogen: LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Protein accession: XP_055866
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114783-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114783-M02A-1-25-1.jpg
Application image note: LMTK3 monoclonal antibody (M02A), clone 2H6 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LMTK3 monoclonal antibody (M02A), clone 2H6 now

Add to cart