LMTK3 monoclonal antibody (M02), clone 2H6 View larger

LMTK3 monoclonal antibody (M02), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMTK3 monoclonal antibody (M02), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about LMTK3 monoclonal antibody (M02), clone 2H6

Brand: Abnova
Reference: H00114783-M02
Product name: LMTK3 monoclonal antibody (M02), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant LMTK3.
Clone: 2H6
Isotype: IgG1 Kappa
Gene id: 114783
Gene name: LMTK3
Gene alias: KIAA1883|LMR3|TYKLM3
Gene description: lemur tyrosine kinase 3
Genbank accession: XM_055866
Immunogen: LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Protein accession: XP_055866
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114783-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114783-M02-1-25-1.jpg
Application image note: LMTK3 monoclonal antibody (M02), clone 2H6 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: LMTK3 Represses Tumor Suppressor-like Genes through Chromatin Remodeling in Breast Cancer.Yichen Xu, Hua Zhang, Van Thuy Mai Nguyen, Nicos Angelopoulos, Joao Nunes, Alistair Reid, Laki Buluwela, Luca Magnani, Justin Stebbing, Georgios Giamas.
Cell Rep. 2015 Aug 4;12(5):837-49.

Reviews

Buy LMTK3 monoclonal antibody (M02), clone 2H6 now

Add to cart