BTBD9 monoclonal antibody (M02), clone 1G3 View larger

BTBD9 monoclonal antibody (M02), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTBD9 monoclonal antibody (M02), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about BTBD9 monoclonal antibody (M02), clone 1G3

Brand: Abnova
Reference: H00114781-M02
Product name: BTBD9 monoclonal antibody (M02), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant BTBD9.
Clone: 1G3
Isotype: IgG2a Kappa
Gene id: 114781
Gene name: BTBD9
Gene alias: FLJ32945|KIAA1880|MGC120517|MGC120519|MGC120520|dJ322I12.1
Gene description: BTB (POZ) domain containing 9
Genbank accession: NM_152733
Immunogen: BTBD9 (NP_689946, 2 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Protein accession: NP_689946
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114781-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114781-M02-13-15-1.jpg
Application image note: Western Blot analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody (M02), clone 1G3.

Lane 1: BTBD9 transfected lysate(65.7 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BTBD9 monoclonal antibody (M02), clone 1G3 now

Add to cart