BTBD9 monoclonal antibody (M01), clone 3H3 View larger

BTBD9 monoclonal antibody (M01), clone 3H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTBD9 monoclonal antibody (M01), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about BTBD9 monoclonal antibody (M01), clone 3H3

Brand: Abnova
Reference: H00114781-M01
Product name: BTBD9 monoclonal antibody (M01), clone 3H3
Product description: Mouse monoclonal antibody raised against a partial recombinant BTBD9.
Clone: 3H3
Isotype: IgG2a Kappa
Gene id: 114781
Gene name: BTBD9
Gene alias: FLJ32945|KIAA1880|MGC120517|MGC120519|MGC120520|dJ322I12.1
Gene description: BTB (POZ) domain containing 9
Genbank accession: NM_152733
Immunogen: BTBD9 (NP_689946, 2 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Protein accession: NP_689946
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114781-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114781-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged BTBD9 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BTBD9 monoclonal antibody (M01), clone 3H3 now

Add to cart