COPl monoclonal antibody (M01), clone 3E10 View larger

COPl monoclonal antibody (M01), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COPl monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about COPl monoclonal antibody (M01), clone 3E10

Brand: Abnova
Reference: H00114769-M01
Product name: COPl monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant COPl.
Clone: 3E10
Isotype: IgG2b Kappa
Gene id: 114769
Gene name: CARD16
Gene alias: COP|COP1|PSEUDO-ICE
Gene description: caspase recruitment domain family, member 16
Genbank accession: NM_052889
Immunogen: COPl (NP_443121, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
Protein accession: NP_443121
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114769-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114769-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged COP1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COPl monoclonal antibody (M01), clone 3E10 now

Add to cart