CYGB monoclonal antibody (M02), clone 1A1 View larger

CYGB monoclonal antibody (M02), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYGB monoclonal antibody (M02), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CYGB monoclonal antibody (M02), clone 1A1

Brand: Abnova
Reference: H00114757-M02
Product name: CYGB monoclonal antibody (M02), clone 1A1
Product description: Mouse monoclonal antibody raised against a full length recombinant CYGB.
Clone: 1A1
Isotype: IgG1 Kappa
Gene id: 114757
Gene name: CYGB
Gene alias: HGB|STAP
Gene description: cytoglobin
Genbank accession: BC029798
Immunogen: CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Protein accession: AAH29798
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114757-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114757-M02-13-15-1.jpg
Application image note: Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1.

Lane 1: CYGB transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.John R, Chand V, Chakraborty S, Jaiswal N, Nag A
DNA Repair (Amst). 2014 Sep 27. pii: S1568-7864(14)00234-1. doi: 10.1016/j.dnarep.2014.09.003.

Reviews

Buy CYGB monoclonal antibody (M02), clone 1A1 now

Add to cart