Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00114757-M02 |
Product name: | CYGB monoclonal antibody (M02), clone 1A1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CYGB. |
Clone: | 1A1 |
Isotype: | IgG1 Kappa |
Gene id: | 114757 |
Gene name: | CYGB |
Gene alias: | HGB|STAP |
Gene description: | cytoglobin |
Genbank accession: | BC029798 |
Immunogen: | CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
Protein accession: | AAH29798 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (46.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1. Lane 1: CYGB transfected lysate(21 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.John R, Chand V, Chakraborty S, Jaiswal N, Nag A DNA Repair (Amst). 2014 Sep 27. pii: S1568-7864(14)00234-1. doi: 10.1016/j.dnarep.2014.09.003. |