Brand: | Abnova |
Reference: | H00114757-M01 |
Product name: | CYGB monoclonal antibody (M01), clone 3A5-2D2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CYGB. |
Clone: | 3A5-2D2 |
Isotype: | IgG2a kappa |
Gene id: | 114757 |
Gene name: | CYGB |
Gene alias: | HGB|STAP |
Gene description: | cytoglobin |
Genbank accession: | BC029798 |
Immunogen: | CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
Protein accession: | AAH29798 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged CYGB is approximately 30ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |