CYGB monoclonal antibody (M01), clone 3A5-2D2 View larger

CYGB monoclonal antibody (M01), clone 3A5-2D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYGB monoclonal antibody (M01), clone 3A5-2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about CYGB monoclonal antibody (M01), clone 3A5-2D2

Brand: Abnova
Reference: H00114757-M01
Product name: CYGB monoclonal antibody (M01), clone 3A5-2D2
Product description: Mouse monoclonal antibody raised against a full length recombinant CYGB.
Clone: 3A5-2D2
Isotype: IgG2a kappa
Gene id: 114757
Gene name: CYGB
Gene alias: HGB|STAP
Gene description: cytoglobin
Genbank accession: BC029798
Immunogen: CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Protein accession: AAH29798
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CYGB is approximately 30ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CYGB monoclonal antibody (M01), clone 3A5-2D2 now

Add to cart