ERMAP monoclonal antibody (M01), clone 6F8 View larger

ERMAP monoclonal antibody (M01), clone 6F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERMAP monoclonal antibody (M01), clone 6F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ERMAP monoclonal antibody (M01), clone 6F8

Brand: Abnova
Reference: H00114625-M01
Product name: ERMAP monoclonal antibody (M01), clone 6F8
Product description: Mouse monoclonal antibody raised against a partial recombinant ERMAP.
Clone: 6F8
Isotype: IgG2a Kappa
Gene id: 114625
Gene name: ERMAP
Gene alias: MGC118810|MGC118811|MGC118812|MGC118813|PRO2801|RD|SC
Gene description: erythroblast membrane-associated protein (Scianna blood group)
Genbank accession: NM_001017922
Immunogen: ERMAP (NP_001017922, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Protein accession: NP_001017922
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114625-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114625-M01-1-1-1.jpg
Application image note: ERMAP monoclonal antibody (M01), clone 6F8 Western Blot analysis of ERMAP expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ERMAP monoclonal antibody (M01), clone 6F8 now

Add to cart