NLRP3 monoclonal antibody (M01), clone 3B1 View larger

NLRP3 monoclonal antibody (M01), clone 3B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLRP3 monoclonal antibody (M01), clone 3B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NLRP3 monoclonal antibody (M01), clone 3B1

Brand: Abnova
Reference: H00114548-M01
Product name: NLRP3 monoclonal antibody (M01), clone 3B1
Product description: Mouse monoclonal antibody raised against a partial recombinant NLRP3.
Clone: 3B1
Isotype: IgG2a Kappa
Gene id: 114548
Gene name: NLRP3
Gene alias: AGTAVPRL|AII|AII/AVP|AVP|C1orf7|CIAS1|CLR1.1|FCAS|FCU|FLJ95925|MWS|NALP3|PYPAF1
Gene description: NLR family, pyrin domain containing 3
Genbank accession: NM_004895
Immunogen: NLRP3 (NP_004886, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR
Protein accession: NP_004886
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114548-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114548-M01-13-15-1.jpg
Application image note: Western Blot analysis of NLRP3 expression in transfected 293T cell line by NLRP3 monoclonal antibody (M01), clone 3B1.

Lane 1: NLRP3 transfected lysate(118.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NLRP3 monoclonal antibody (M01), clone 3B1 now

Add to cart