CGB2 monoclonal antibody (M02A), clone 4F8 View larger

CGB2 monoclonal antibody (M02A), clone 4F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CGB2 monoclonal antibody (M02A), clone 4F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CGB2 monoclonal antibody (M02A), clone 4F8

Brand: Abnova
Reference: H00114336-M02A
Product name: CGB2 monoclonal antibody (M02A), clone 4F8
Product description: Mouse monoclonal antibody raised against a partial recombinant CGB2.
Clone: 4F8
Isotype: IgG2a Kappa
Gene id: 114336
Gene name: CGB2
Gene alias: -
Gene description: chorionic gonadotropin, beta polypeptide 2
Genbank accession: NM_033378
Immunogen: CGB2 (NP_203696, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG
Protein accession: NP_203696
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114336-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CGB2 monoclonal antibody (M02A), clone 4F8 now

Add to cart