Brand: | Abnova |
Reference: | H00114336-M02 |
Product name: | CGB2 monoclonal antibody (M02), clone 4F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CGB2. |
Clone: | 4F8 |
Isotype: | IgG2a Kappa |
Gene id: | 114336 |
Gene name: | CGB2 |
Gene alias: | - |
Gene description: | chorionic gonadotropin, beta polypeptide 2 |
Genbank accession: | NM_033378 |
Immunogen: | CGB2 (NP_203696, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG |
Protein accession: | NP_203696 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |