Brand: | Abnova |
Reference: | H00114327-M09 |
Product name: | EFHC1 monoclonal antibody (M09), clone 4E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EFHC1. |
Clone: | 4E7 |
Isotype: | IgG2a Kappa |
Gene id: | 114327 |
Gene name: | EFHC1 |
Gene alias: | EJM|EJM1|FLJ10466|FLJ37290|JAE|dJ304B14.2 |
Gene description: | EF-hand domain (C-terminal) containing 1 |
Genbank accession: | NM_018100 |
Immunogen: | EFHC1 (NP_060570.1, 270 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVK |
Protein accession: | NP_060570.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EFHC1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |