EFHC1 monoclonal antibody (M09), clone 4E7 View larger

EFHC1 monoclonal antibody (M09), clone 4E7

H00114327-M09_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EFHC1 monoclonal antibody (M09), clone 4E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about EFHC1 monoclonal antibody (M09), clone 4E7

Brand: Abnova
Reference: H00114327-M09
Product name: EFHC1 monoclonal antibody (M09), clone 4E7
Product description: Mouse monoclonal antibody raised against a partial recombinant EFHC1.
Clone: 4E7
Isotype: IgG2a Kappa
Gene id: 114327
Gene name: EFHC1
Gene alias: EJM|EJM1|FLJ10466|FLJ37290|JAE|dJ304B14.2
Gene description: EF-hand domain (C-terminal) containing 1
Genbank accession: NM_018100
Immunogen: EFHC1 (NP_060570.1, 270 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVK
Protein accession: NP_060570.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114327-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged EFHC1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EFHC1 monoclonal antibody (M09), clone 4E7 now

Add to cart