Brand: | Abnova |
Reference: | H00114299-M09 |
Product name: | PALM2 monoclonal antibody (M09), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PALM2. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 114299 |
Gene name: | PALM2 |
Gene alias: | AKAP2 |
Gene description: | paralemmin 2 |
Genbank accession: | NM_053016 |
Immunogen: | PALM2 (NP_443749, 321 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM |
Protein accession: | NP_443749 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | PALM2 monoclonal antibody (M09), clone 1A8 Western Blot analysis of PALM2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |