PALM2 monoclonal antibody (M09), clone 1A8 View larger

PALM2 monoclonal antibody (M09), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PALM2 monoclonal antibody (M09), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PALM2 monoclonal antibody (M09), clone 1A8

Brand: Abnova
Reference: H00114299-M09
Product name: PALM2 monoclonal antibody (M09), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant PALM2.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 114299
Gene name: PALM2
Gene alias: AKAP2
Gene description: paralemmin 2
Genbank accession: NM_053016
Immunogen: PALM2 (NP_443749, 321 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM
Protein accession: NP_443749
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114299-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00114299-M09-1-25-1.jpg
Application image note: PALM2 monoclonal antibody (M09), clone 1A8 Western Blot analysis of PALM2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PALM2 monoclonal antibody (M09), clone 1A8 now

Add to cart