Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00114088-M01 |
Product name: | TRIM9 monoclonal antibody (M01), clone 1F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM9. |
Clone: | 1F12 |
Isotype: | IgG2b Kappa |
Gene id: | 114088 |
Gene name: | TRIM9 |
Gene alias: | KIAA0282|RNF91|SPRING |
Gene description: | tripartite motif-containing 9 |
Genbank accession: | NM_015163.5 |
Immunogen: | TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP |
Protein accession: | NP_055978.4 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12. Lane 1: TRIM9 transfected lysate(61.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.Winkle CC, McClain LM, Valtschanoff JG, Park CS, Maglione C, Gupton SL J Cell Biol. 2014 Apr 28;205(2):217-32. doi: 10.1083/jcb.201311003. |