TRIM9 monoclonal antibody (M01), clone 1F12 View larger

TRIM9 monoclonal antibody (M01), clone 1F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM9 monoclonal antibody (M01), clone 1F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about TRIM9 monoclonal antibody (M01), clone 1F12

Brand: Abnova
Reference: H00114088-M01
Product name: TRIM9 monoclonal antibody (M01), clone 1F12
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM9.
Clone: 1F12
Isotype: IgG2b Kappa
Gene id: 114088
Gene name: TRIM9
Gene alias: KIAA0282|RNF91|SPRING
Gene description: tripartite motif-containing 9
Genbank accession: NM_015163.5
Immunogen: TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP
Protein accession: NP_055978.4
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114088-M01-13-15-1.jpg
Application image note: Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12.

Lane 1: TRIM9 transfected lysate(61.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice
Publications: A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.Winkle CC, McClain LM, Valtschanoff JG, Park CS, Maglione C, Gupton SL
J Cell Biol. 2014 Apr 28;205(2):217-32. doi: 10.1083/jcb.201311003.

Reviews

Buy TRIM9 monoclonal antibody (M01), clone 1F12 now

Add to cart