TRIM9 polyclonal antibody (A01) View larger

TRIM9 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM9 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TRIM9 polyclonal antibody (A01)

Brand: Abnova
Reference: H00114088-A01
Product name: TRIM9 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TRIM9.
Gene id: 114088
Gene name: TRIM9
Gene alias: KIAA0282|RNF91|SPRING
Gene description: tripartite motif-containing 9
Genbank accession: NM_015163.5
Immunogen: TRIM9 (NP_055978, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP
Protein accession: NP_055978.4
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114088-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114088-A01-1-23-1.jpg
Application image note: TRIM9 polyclonal antibody (A01), Lot # 051121JC01 Western Blot analysis of TRIM9 expression in U-2 OS ( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRIM9 polyclonal antibody (A01) now

Add to cart