WBSCR22 monoclonal antibody (M11), clone 2E12 View larger

WBSCR22 monoclonal antibody (M11), clone 2E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WBSCR22 monoclonal antibody (M11), clone 2E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,IP

More info about WBSCR22 monoclonal antibody (M11), clone 2E12

Brand: Abnova
Reference: H00114049-M11
Product name: WBSCR22 monoclonal antibody (M11), clone 2E12
Product description: Mouse monoclonal antibody raised against a partial recombinant WBSCR22.
Clone: 2E12
Isotype: IgG2a Kappa
Gene id: 114049
Gene name: WBSCR22
Gene alias: HASJ4442|HUSSY-3|MGC19709|MGC2022|MGC5140|PP3381|WBMT
Gene description: Williams Beuren syndrome chromosome region 22
Genbank accession: NM_017528
Immunogen: WBSCR22 (NP_059998.2, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIP
Protein accession: NP_059998.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00114049-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00114049-M11-31-15-1.jpg
Application image note: Immunoprecipitation of WBSCR22 transfected lysate using anti-WBSCR22 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WBSCR22 MaxPab rabbit polyclonal antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy WBSCR22 monoclonal antibody (M11), clone 2E12 now

Add to cart