Brand: | Abnova |
Reference: | H00114049-M11 |
Product name: | WBSCR22 monoclonal antibody (M11), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WBSCR22. |
Clone: | 2E12 |
Isotype: | IgG2a Kappa |
Gene id: | 114049 |
Gene name: | WBSCR22 |
Gene alias: | HASJ4442|HUSSY-3|MGC19709|MGC2022|MGC5140|PP3381|WBMT |
Gene description: | Williams Beuren syndrome chromosome region 22 |
Genbank accession: | NM_017528 |
Immunogen: | WBSCR22 (NP_059998.2, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIP |
Protein accession: | NP_059998.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of WBSCR22 transfected lysate using anti-WBSCR22 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WBSCR22 MaxPab rabbit polyclonal antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |