HEL308 polyclonal antibody (A01) View larger

HEL308 polyclonal antibody (A01)

H00113510-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEL308 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HEL308 polyclonal antibody (A01)

Brand: Abnova
Reference: H00113510-A01
Product name: HEL308 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HEL308.
Gene id: 113510
Gene name: HEL308
Gene alias: MGC20604
Gene description: DNA helicase HEL308
Genbank accession: NM_133636
Immunogen: HEL308 (NP_598375, 275 a.a. ~ 337 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLY
Protein accession: NP_598375
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00113510-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.04 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00113510-A01-1-2-1.jpg
Application image note: HEL308 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of HEL308 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HEL308 polyclonal antibody (A01) now

Add to cart