TMEM54 purified MaxPab rabbit polyclonal antibody (D01P) View larger

TMEM54 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM54 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about TMEM54 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00113452-D01P
Product name: TMEM54 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TMEM54 protein.
Gene id: 113452
Gene name: TMEM54
Gene alias: BCLP|CAC-1|CAC1|MGC10137
Gene description: transmembrane protein 54
Genbank accession: BC023260
Immunogen: TMEM54 (AAH23260.1, 1 a.a. ~ 169 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIVGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL
Protein accession: AAH23260.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00113452-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TMEM54 expression in transfected 293T cell line (H00113452-T02) by TMEM54 MaxPab polyclonal antibody.

Lane 1: TMEM54 transfected lysate(18.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TMEM54 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart