MED8 monoclonal antibody (M01), clone 1D3 View larger

MED8 monoclonal antibody (M01), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MED8 monoclonal antibody (M01), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MED8 monoclonal antibody (M01), clone 1D3

Brand: Abnova
Reference: H00112950-M01
Product name: MED8 monoclonal antibody (M01), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant MED8.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 112950
Gene name: MED8
Gene alias: ARC32|MGC17544|MGC19641
Gene description: mediator complex subunit 8
Genbank accession: NM_052877
Immunogen: MED8 (NP_443109, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
Protein accession: NP_443109
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00112950-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112950-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MED8 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MED8 monoclonal antibody (M01), clone 1D3 now

Add to cart