TP53RK monoclonal antibody (M06), clone 2E8 View larger

TP53RK monoclonal antibody (M06), clone 2E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53RK monoclonal antibody (M06), clone 2E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA

More info about TP53RK monoclonal antibody (M06), clone 2E8

Brand: Abnova
Reference: H00112858-M06
Product name: TP53RK monoclonal antibody (M06), clone 2E8
Product description: Mouse monoclonal antibody raised against a partial recombinant TP53RK.
Clone: 2E8
Isotype: IgG1 Kappa
Gene id: 112858
Gene name: TP53RK
Gene alias: BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2
Gene description: TP53 regulating kinase
Genbank accession: BC009727
Immunogen: TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Protein accession: AAH09727
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112858-M06-3-51-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TP53RK on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TP53RK monoclonal antibody (M06), clone 2E8 now

Add to cart