TP53RK monoclonal antibody (M05), clone 2E10 View larger

TP53RK monoclonal antibody (M05), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53RK monoclonal antibody (M05), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about TP53RK monoclonal antibody (M05), clone 2E10

Brand: Abnova
Reference: H00112858-M05
Product name: TP53RK monoclonal antibody (M05), clone 2E10
Product description: Mouse monoclonal antibody raised against a partial recombinant TP53RK.
Clone: 2E10
Isotype: IgG2b Kappa
Gene id: 112858
Gene name: TP53RK
Gene alias: BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2
Gene description: TP53 regulating kinase
Genbank accession: BC009727
Immunogen: TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Protein accession: AAH09727
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00112858-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112858-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TP53RK is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TP53RK monoclonal antibody (M05), clone 2E10 now

Add to cart