Brand: | Abnova |
Reference: | H00112858-M03 |
Product name: | TP53RK monoclonal antibody (M03), clone 3A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TP53RK. |
Clone: | 3A1 |
Isotype: | IgG2b Kappa |
Gene id: | 112858 |
Gene name: | TP53RK |
Gene alias: | BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2 |
Gene description: | TP53 regulating kinase |
Genbank accession: | BC009727 |
Immunogen: | TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG |
Protein accession: | AAH09727 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TP53RK on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |