KRT71 monoclonal antibody (M02), clone 1D4 View larger

KRT71 monoclonal antibody (M02), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KRT71 monoclonal antibody (M02), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about KRT71 monoclonal antibody (M02), clone 1D4

Brand: Abnova
Reference: H00112802-M02
Product name: KRT71 monoclonal antibody (M02), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant KRT71.
Clone: 1D4
Isotype: IgG2a Kappa
Gene id: 112802
Gene name: KRT71
Gene alias: K6IRS1|KRT6IRS|KRT6IRS1|MGC119390|MGC119391
Gene description: keratin 71
Genbank accession: NM_033448
Immunogen: KRT71 (NP_258259.1, 251 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL
Protein accession: NP_258259.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00112802-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112802-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged KRT71 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KRT71 monoclonal antibody (M02), clone 1D4 now

Add to cart