IL17F monoclonal antibody (M01), clone 1E5 View larger

IL17F monoclonal antibody (M01), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL17F monoclonal antibody (M01), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL17F monoclonal antibody (M01), clone 1E5

Brand: Abnova
Reference: H00112744-M01
Product name: IL17F monoclonal antibody (M01), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant IL17F.
Clone: 1E5
Isotype: IgG2a Kappa
Gene id: 112744
Gene name: IL17F
Gene alias: IL-17F|ML-1|ML1
Gene description: interleukin 17F
Genbank accession: NM_052872
Immunogen: IL17F (NP_443104, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS
Protein accession: NP_443104
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00112744-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112744-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IL17F is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL17F monoclonal antibody (M01), clone 1E5 now

Add to cart