CMTM7 monoclonal antibody (M01A), clone S1 View larger

CMTM7 monoclonal antibody (M01A), clone S1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CMTM7 monoclonal antibody (M01A), clone S1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CMTM7 monoclonal antibody (M01A), clone S1

Brand: Abnova
Reference: H00112616-M01A
Product name: CMTM7 monoclonal antibody (M01A), clone S1
Product description: Mouse monoclonal antibody raised against a full-length recombinant CMTM7.
Clone: S1
Isotype: IgG1 Kappa
Gene id: 112616
Gene name: CMTM7
Gene alias: CKLFSF7|FLJ30992
Gene description: CKLF-like MARVEL transmembrane domain containing 7
Genbank accession: BC010116.1
Immunogen: CMTM7 (AAH10116.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Protein accession: AAH10116.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CMTM7 monoclonal antibody (M01A), clone S1 now

Add to cart