Brand: | Abnova |
Reference: | H00112616-M01 |
Product name: | CKLFSF7 monoclonal antibody (M01), clone 2B1-G4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CKLFSF7. |
Clone: | 2B1-G4 |
Isotype: | IgG1 kappa |
Gene id: | 112616 |
Gene name: | CMTM7 |
Gene alias: | CKLFSF7|FLJ30992 |
Gene description: | CKLF-like MARVEL transmembrane domain containing 7 |
Genbank accession: | BC010116 |
Immunogen: | CKLFSF7 (AAH10116, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV |
Protein accession: | AAH10116 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |