C14orf126 monoclonal antibody (M06), clone 7B8 View larger

C14orf126 monoclonal antibody (M06), clone 7B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C14orf126 monoclonal antibody (M06), clone 7B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about C14orf126 monoclonal antibody (M06), clone 7B8

Brand: Abnova
Reference: H00112487-M06
Product name: C14orf126 monoclonal antibody (M06), clone 7B8
Product description: Mouse monoclonal antibody raised against a full-length recombinant C14orf126.
Clone: 7B8
Isotype: IgG2b Kappa
Gene id: 112487
Gene name: C14orf126
Gene alias: MGC9912
Gene description: chromosome 14 open reading frame 126
Genbank accession: NM_080664.2
Immunogen: C14orf126 (NP_542395.1, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF
Protein accession: NP_542395.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112487-M06-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged C14orf126 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy C14orf126 monoclonal antibody (M06), clone 7B8 now

Add to cart