Brand: | Abnova |
Reference: | H00112487-M06 |
Product name: | C14orf126 monoclonal antibody (M06), clone 7B8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant C14orf126. |
Clone: | 7B8 |
Isotype: | IgG2b Kappa |
Gene id: | 112487 |
Gene name: | C14orf126 |
Gene alias: | MGC9912 |
Gene description: | chromosome 14 open reading frame 126 |
Genbank accession: | NM_080664.2 |
Immunogen: | C14orf126 (NP_542395.1, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF |
Protein accession: | NP_542395.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged C14orf126 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |